BPC-157 and TB-500 are two of the most-cited compounds in tissue-repair peptide research. They appear in the literature alone, in combination, and across overlapping endpoints — wound-healing, vascular repair, tendon and ligament work, gastrointestinal-mucosa investigation. This frequent co-citation is exactly why researchers ask how they differ.

This article is a structured side-by-side: identifiers, structure class, mechanism category, half-life characteristics, and the published literature. Everything is research-frame language. No protocol guidance. No clinical claims.

Research use only

Both BPC-157 and TB-500 are supplied as lyophilized powder for laboratory research only. Not for human or veterinary use, not approved as medicines, no clinical authorization. This article documents what published peer-reviewed research has investigated — it is not a protocol, dosing guide, or therapeutic recommendation.

Quick reference

Property BPC-157 TB-500 (Thymosin β-4 fragment)
CAS number 137525-51-0 77591-33-4
PubChem CID 108101 —
Molecular formula C62H98N16O22 C212H350N56O78S
Molecular weight 1419.55 g/mol 4963.44 g/mol
Sequence GEPPPGKPADDAGLV (15 aa) SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa)
Class Stable gastric pentadecapeptide Thymosin β-4 N-terminal fragment
Active research areas Gastrointestinal mucosa, tendon repair, vascular stability, angiogenesis Actin-binding regulation, wound-healing, cardiac repair, angiogenesis

What the structure tells you

BPC-157 is a 15-amino-acid peptide with sequence GEPPPGKPADDAGLV, originally isolated as a stable fragment of human gastric juice protein BPC. The “stable” part of “stable gastric pentadecapeptide” matters: it survives intact through acidic environments. That stability is core to why it’s been investigated across so many tissue contexts [1].

TB-500 is the synthetic name commonly used for a 43-amino-acid fragment of thymosin β-4, the actin-sequestering protein. The shorter active-fragment sequence Ac-SDKP appears in much of the underlying TB-500 literature. Where BPC-157 acts at signaling-pathway scale, TB-500 acts at cytoskeletal scale — actin polymerization is its mechanism category [2].

That structural difference produces different research footprints. BPC-157 work concentrates around gastrointestinal mucosa, tendon-to-bone enthesis healing, and angiogenesis through VEGF / NO-synthase pathways. TB-500 concentrates around cardiac repair, wound-healing closure, and corneal regeneration — all connected back to actin-cytoskeleton work [3].

Mechanism class — different, sometimes complementary

The two peptides aren’t doing the same thing. They show up together in research because they touch overlapping endpoints from different mechanisms:

  • BPC-157 appears to modulate growth-factor signaling and nitric-oxide pathways, with effects observed across tendon, ligament, and mucosal models. The published literature emphasizes its role in stabilizing damaged tissue rather than driving new-tissue synthesis directly.
  • TB-500 regulates the actin cytoskeleton — it sequesters monomeric G-actin, controlling the available pool for filament assembly. This is why it appears in studies of cell migration, vessel formation, and wound-edge mobility.

Researchers co-investigating both compounds often frame them as complementary: signaling-stabilization plus cytoskeletal-mobility. That framing is research-context — not a clinical recommendation, not a protocol. The published literature treats them as separate research tools that converge on shared endpoints.

Half-life and stability

Why half-life matters in research

In laboratory research design, plasma half-life informs dosing-frequency hypotheses but does not equal “duration of effect.” Tissue-binding, receptor-occupancy, and downstream-pathway kinetics all factor in. Treat published half-life numbers as one variable, not the whole picture.

BPC-157 is reported in research models with relatively short plasma half-life (minutes-to-low-hours range in animal models), but its functional effects in published literature persist far longer than half-life alone would predict — likely because the effects are downstream-pathway, not direct receptor-occupancy.

TB-500 / Tβ4 fragment plasma half-life is reported as longer (multi-hour range in animal models). Cytoskeletal regulation is a sustained process — which fits the literature pattern of TB-500 being investigated with less-frequent administration in research designs.

Storage and handling

Both peptides ship as lyophilized powder. Standard research-handling literature documents:

  • Lyophilized state: sealed at −20°C, protected from light. Stable for the manufacturer-stated window.
  • Reconstituted state: bacteriostatic water (0.9% benzyl alcohol) is the standard diluent for both. Refrigerate at 2–8°C after reconstitution. Common research-handling literature suggests use within ~4 weeks of reconstitution under refrigerated conditions, though specific stability depends on concentration and handling.
  • BAC water enables multi-puncture vials — the preservative inhibits microbial growth across repeated access in research protocols, typically up to ~28 days under refrigeration.

Each TogoPeptide shipment of either compound includes a per-batch Certificate of Analysis — HPLC purity (target ≥98%), mass-spectrometry identity confirmation, lot number, analysis date.

The combination in the literature

BPC-157 + TB-500 co-investigation appears across multiple research models. The framing in published literature is generally that the two peptides target the same broad endpoint (tissue-repair quality and rate) through distinct upstream mechanisms — making the combination a research tool for separating signaling-pathway effects from cytoskeletal-pathway effects.

Researchers using both as a paired investigation typically follow a research-protocol design that documents:

  1. Independent compound characterization (purity, identity, batch traceability)
  2. Vehicle-only and single-compound control arms
  3. Combination arm to test for synergy or additive effects
  4. Endpoint measurements across both signaling markers (growth-factor expression) and cytoskeletal markers (actin dynamics, cell migration)

This is methodology context, not a protocol guide. Published research designs vary substantially by model system, investigator, and target endpoint.

Practical research-supply considerations

From a research-supply standpoint:

  • Vial-strength selection: BPC-157 ships in 5 mg / 10 mg / 20 mg lyophilized vials. TB-500 in 5 mg / 10 mg. BPC-157 + TB-500 also ships as a pre-mixed combination blend in 10 / 20 / 30 mg total-mass vials for paired research designs.
  • Reconstitution math: standard research handling diluent volumes vary by experimental concentration target. Use our reconstitution calculator to compute volume per target concentration.
  • Batch traceability: every shipment includes the lot number and HPLC chromatogram on the COA. For multi-batch research designs, request matching lot numbers at order time.

Closing — what this comparison does and doesn’t say

This article documents what published peer-reviewed research has investigated for BPC-157 and TB-500. It is structural-context for laboratory researchers, not therapeutic recommendation, not protocol guidance, not a basis for self-administration of any kind.

If you’re sourcing either peptide for laboratory research:

For methodology and laboratory-handling questions, contact our research-supply team at info@togopeptide.com.

References

  1. Sikiric P, et al. Stable gastric pentadecapeptide BPC 157 in trials for inflammatory bowel disease. Curr Pharm Des. 2012. PubMedPMID: 23012670
  2. Goldstein AL, Hannappel E, Sosne G, Kleinman HK. Thymosin β4: actin regulation and beyond. Ann N Y Acad Sci. 2010. PubMedPMID: 20536502
  3. Kleinman HK, Sosne G. Thymosin β4 and cardiac repair. Ann N Y Acad Sci. 2012. PubMedPMID: 22416826
  4. Sikiric P, et al. BPC 157 and standard angiogenic growth factors. J Physiol Pharmacol. 2018. PubMedPMID: 29879889
  5. Sikiric P, et al. Pentadecapeptide BPC 157 as therapy for tendon healing. Biomedicines. 2020. PubMedPMID: 31995085